SCOPe 2.08: Domain d1vmob_: 1vmo B:

Lineage for d1vmob_ (1vmo B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.77: beta-Prism I [51091] (4 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.1: Vitelline membrane outer protein-I (VMO-I) [51092] (1 family)
   automatically mapped to Pfam PF03762

5. Family b.77.1.1: Vitelline membrane outer protein-I (VMO-I) [51093] (1 protein)

6. Protein Vitelline membrane outer protein-I (VMO-I) [51094] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [51095] (1 PDB entry)

8. Domain d1vmob_: 1vmo B: [27975]

Details for d1vmob_

PDB Entry: 1vmo, 2.2 Å

PDB Description: crystal structure of vitelline membrane outer layer protein i (vmo-i): a folding motif with homologous greek key structures related by an internal three-fold symmetry

PDB Compounds: (B:) vitelline membrane outer layer protein I

SCOPe Domain Sequences for d1vmob_:

Sequence; same for both SEQRES and ATOM records:

>d1vmob_ b.77.1.1 (B:) Vitelline membrane outer protein-I (VMO-I) {Chicken (Gallus gallus) [TaxId: 9031]}
rtreytsvitvpngghwgkwgirqfchsgyangfalkvepsqfgrddtalngirlrcldg
svieslvgkwgtwtsflvcptgylvsfslrseksqgggddtaanniqfrcsdeavlvgdg
lswgrfgpwskrckicglqtkvespqglrddtalnnvrffcck

Timeline for d1vmob_:

• d1vmob_ first appeared (with stable ids) in SCOP 1.55
  
• d1vmob_ appears in SCOPe 2.07