Lineage for d5edqa_ (5edq A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543502Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2543503Species Human (Homo sapiens) [TaxId:9606] [82796] (109 PDB entries)
    Uniprot P00533 702-1018
  8. 2543595Domain d5edqa_: 5edq A: [279747]
    automated match to d4li5a_
    complexed with 5n3

Details for d5edqa_

PDB Entry: 5edq (more details), 2.8 Å

PDB Description: egfr kinase (t790m/l858r) with inhibitor compound 15: ~{n}-(7- chloranyl-1~{h}-indazol-3-yl)-7,7-dimethyl-2-(1~{h}-pyrazol-4-yl)- 5~{h}-furo[3,4-d]pyrimidin-4-amine
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d5edqa_:

Sequence, based on SEQRES records: (download)

>d5edqa_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaaaaeyhaeggkv
pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsn
fyralmdeedmddvvdadeyli

Sequence, based on observed residues (ATOM records): (download)

>d5edqa_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgravpikwmalesilhriyt
hqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwm
idadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfdmddvvdadeyli

SCOPe Domain Coordinates for d5edqa_:

Click to download the PDB-style file with coordinates for d5edqa_.
(The format of our PDB-style files is described here.)

Timeline for d5edqa_: