SCOPe 2.08: Domain d5ecje_: 5ecj E:

Lineage for d5ecje_ (5ecj E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d5ecje_: 5ecj E: [279738]
   automated match to d3uyod_

Details for d5ecje_

PDB Entry: 5ecj, 3.05 Å

PDB Description: crystal structure of monobody mb(s4) bound to prdm14 in complex with mtgr1

PDB Compounds: (E:) Monobody Mb(S4)

SCOPe Domain Sequences for d5ecje_:

Sequence; same for both SEQRES and ATOM records:

>d5ecje_ b.1.2.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vssvptklevvaatptslliswdapavtvdlyfitygetggnspvqkftvpgskstatis
glkpgvdytitvyaqyyyrgwyvgspisinyrt

Timeline for d5ecje_:

• d5ecje_ first appeared in SCOPe 2.05
  
• d5ecje_ appears in SCOPe 2.07