SCOPe 2.05: Domain d5e4wa_: 5e4w A:

Lineage for d5e4wa_ (5e4w A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [279735] (1 PDB entry)

8. Domain d5e4wa_: 5e4w A: [279737]
   automated match to d2trxa_
   complexed with ca, gol

Details for d5e4wa_

PDB Entry: 5e4w, 2.8 Å

PDB Description: crystal structure of cpsrp43 chromodomains 2 and 3 in complex with the alb3 tail

PDB Compounds: (A:) Thioredoxin-1

SCOPe Domain Sequences for d5e4wa_:

Sequence; same for both SEQRES and ATOM records:

>d5e4wa_ c.47.1.1 (A:) automated matches {Escherichia coli [TaxId: 83334]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanlags

Timeline for d5e4wa_:

• d5e4wa_ is new in SCOPe 2.05-stable
  
• d5e4wa_ is called d5e4wa1 in SCOPe 2.06
  
• d5e4wa_ appears in the current release, SCOPe 2.08, called d5e4wa1