Lineage for d5e30c_ (5e30 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778588Species Influenza a virus [TaxId:1092915] [279720] (1 PDB entry)
  8. 1778590Domain d5e30c_: 5e30 C: [279732]
    Other proteins in same PDB: d5e30b_, d5e30d_, d5e30f_
    automated match to d4bh4a_
    complexed with fuc, ful, gal, nag, sia; mutant

Details for d5e30c_

PDB Entry: 5e30 (more details), 2.7 Å

PDB Description: crystal structure of h5 hemagglutinin q226l mutant from the influenza virus a/duck/egypt/10185ss/2010 (h5n1) with lstc
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d5e30c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e30c_ b.19.1.2 (C:) automated matches {Influenza a virus [TaxId: 1092915]}
dpgdqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcsv
agwllgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqit
pknswsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgi
hhpndateqtrlyqnpttyisvgtstlnqklvpkiatrskvkglsgrmeffwtilksnda
infesngnfiapenaykivkkgdstimkseleygdcntkcqtpigainssmpfhnihplt
igecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d5e30c_:

Click to download the PDB-style file with coordinates for d5e30c_.
(The format of our PDB-style files is described here.)

Timeline for d5e30c_:

  • d5e30c_ appears in periodic updates to SCOPe 2.05 starting on 2015-12-02
  • d5e30c_ is called d5e30c1 in SCOPe 2.06
  • d5e30c_ appears in the current release, SCOPe 2.07, called d5e30c1