Lineage for d5e30c1 (5e30 C:11-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775544Species Influenza A virus (a/duck/egypt/10185ss/2010(h5n1)) [TaxId:1092915] [311104] (3 PDB entries)
  8. 2775552Domain d5e30c1: 5e30 C:11-324 [279732]
    Other proteins in same PDB: d5e30a2, d5e30b_, d5e30c2, d5e30d_, d5e30e2, d5e30f_
    automated match to d4bh4a_
    complexed with nag; mutant

Details for d5e30c1

PDB Entry: 5e30 (more details), 2.7 Å

PDB Description: crystal structure of h5 hemagglutinin q226l mutant from the influenza virus a/duck/egypt/10185ss/2010 (h5n1) with lstc
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d5e30c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e30c1 b.19.1.2 (C:11-324) Hemagglutinin {Influenza A virus (a/duck/egypt/10185ss/2010(h5n1)) [TaxId: 1092915]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqitpkn
swsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgihhp
ndateqtrlyqnpttyisvgtstlnqklvpkiatrskvkglsgrmeffwtilksndainf
esngnfiapenaykivkkgdstimkseleygdcntkcqtpigainssmpfhnihpltige
cpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d5e30c1:

Click to download the PDB-style file with coordinates for d5e30c1.
(The format of our PDB-style files is described here.)

Timeline for d5e30c1: