Lineage for d5e34a1 (5e34 A:11-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775540Species Influenza A virus (a/chicken/vietnam/ncvd-093/2008(h5n1)) [TaxId:581024] [279718] (3 PDB entries)
  8. 2775541Domain d5e34a1: 5e34 A:11-324 [279730]
    Other proteins in same PDB: d5e34a2, d5e34b_
    automated match to d4n5ya_
    complexed with nag; mutant

Details for d5e34a1

PDB Entry: 5e34 (more details), 2.7 Å

PDB Description: crystal structure of h5 hemagglutinin mutant (n224k, q226l, n158d and l133a deletion) from the influenza virus a/chicken/vietnam/ncvd- 093/2008 (h5n1) with lsta
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5e34a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e34a1 b.19.1.2 (A:11-324) Hemagglutinin {Influenza A virus (a/chicken/vietnam/ncvd-093/2008(h5n1)) [TaxId: 581024]}
dqicvgyhannsteqvdtimeknitvthaqdilekthngklcnlngvkplilkdcsvagw
llgnpmcdeflnvsewsyivekaspanglcypgdfndyeelkhllsrinhfekikiipks
ywsnhetsgvssacsylenpsffrnvvwltkkdntyppikvnytnanqkdllvlwgihhp
nneaeqkmiyqnlntyvsvgtstlnqrlvpkiatrskvkglsgrmdffwtilkpndtinf
dsngnfiapeyaykivkkgdsaimkseleygncntkcqtpigainssmpfhnihpltige
cpkyvksnrlvlatglrnap

SCOPe Domain Coordinates for d5e34a1:

Click to download the PDB-style file with coordinates for d5e34a1.
(The format of our PDB-style files is described here.)

Timeline for d5e34a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5e34a2
View in 3D
Domains from other chains:
(mouse over for more information)
d5e34b_