Lineage for d5e4xa_ (5e4x A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785156Protein automated matches [191035] (3 species)
    not a true protein
  7. 2785196Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [279724] (2 PDB entries)
  8. 2785197Domain d5e4xa_: 5e4x A: [279725]
    automated match to d1x3pa1
    complexed with mg

Details for d5e4xa_

PDB Entry: 5e4x (more details), 2.75 Å

PDB Description: crystal structure of cpsrp43 chromodomain 3
PDB Compounds: (A:) Signal recognition particle 43 kDa protein, chloroplastic

SCOPe Domain Sequences for d5e4xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e4xa_ b.34.13.2 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
yavaesvigkrvgddgktieylvkwtdmsdatwepqdnvdstlvllyqqq

SCOPe Domain Coordinates for d5e4xa_:

Click to download the PDB-style file with coordinates for d5e4xa_.
(The format of our PDB-style files is described here.)

Timeline for d5e4xa_: