SCOPe 2.08: Domain d5e4xa_: 5e4x A:

Lineage for d5e4xa_ (5e4x A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein automated matches [191035] (3 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [279724] (2 PDB entries)

8. Domain d5e4xa_: 5e4x A: [279725]
   automated match to d1x3pa1
   complexed with mg

Details for d5e4xa_

PDB Entry: 5e4x, 2.75 Å

PDB Description: crystal structure of cpsrp43 chromodomain 3

PDB Compounds: (A:) Signal recognition particle 43 kDa protein, chloroplastic

SCOPe Domain Sequences for d5e4xa_:

Sequence; same for both SEQRES and ATOM records:

>d5e4xa_ b.34.13.2 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
yavaesvigkrvgddgktieylvkwtdmsdatwepqdnvdstlvllyqqq

Timeline for d5e4xa_:

• d5e4xa_ first appeared in SCOPe 2.05
  
• d5e4xa_ appears in SCOPe 2.07