Lineage for d5e4ea_ (5e4e A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705579Protein Interleukin-13 (IL-13) [63532] (1 species)
  7. 2705580Species Human (Homo sapiens) [TaxId:9606] [63533] (13 PDB entries)
  8. 2705586Domain d5e4ea_: 5e4e A: [279723]
    Other proteins in same PDB: d5e4eb1, d5e4eb2
    automated match to d1ik0a_
    complexed with nag, so4

Details for d5e4ea_

PDB Entry: 5e4e (more details), 3 Å

PDB Description: engineered interleukin-13 bound to receptor
PDB Compounds: (A:) interleukin-13

SCOPe Domain Sequences for d5e4ea_:

Sequence, based on SEQRES records: (download)

>d5e4ea_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
pgpvppstavrelieelinitqnqkaplcngsmvwsinrtagmycaaleslinvsgcsai
ektqrmlsgfcphkvsagqfsslhvrsskievaqfvkdllfhlrtlfregqfn

Sequence, based on observed residues (ATOM records): (download)

>d5e4ea_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
pgpvppstavrelieelinitqnaplcngsmvwsinrtagmycaaleslinvsgcsaiek
tqrmlsgfcphkvsagqfsslhvrsskievaqfvkdllfhlrtlfregqfn

SCOPe Domain Coordinates for d5e4ea_:

Click to download the PDB-style file with coordinates for d5e4ea_.
(The format of our PDB-style files is described here.)

Timeline for d5e4ea_: