Lineage for d5e2yc1 (5e2y C:11-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040328Species Influenza a virus (a/duck/egypt/10185ss/2010(h5n1)) [TaxId:1092915] [311104] (3 PDB entries)
  8. 2040330Domain d5e2yc1: 5e2y C:11-324 [279722]
    Other proteins in same PDB: d5e2ya2, d5e2yb1, d5e2yb2, d5e2yc2, d5e2yd1, d5e2yd2, d5e2ye2, d5e2yf1, d5e2yf2
    automated match to d4bh4a_
    complexed with fuc, ful, nag; mutant

Details for d5e2yc1

PDB Entry: 5e2y (more details), 2.6 Å

PDB Description: crystal structure of h5 hemagglutinin q226l mutant from the influenza virus a/duck/egypt/10185ss/2010 (h5n1)
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d5e2yc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e2yc1 b.19.1.2 (C:11-324) Hemagglutinin {Influenza a virus (a/duck/egypt/10185ss/2010(h5n1)) [TaxId: 1092915]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqitpkn
swsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgihhp
ndateqtrlyqnpttyisvgtstlnqklvpkiatrskvkglsgrmeffwtilksndainf
esngnfiapenaykivkkgdstimkseleygdcntkcqtpigainssmpfhnihpltige
cpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d5e2yc1:

Click to download the PDB-style file with coordinates for d5e2yc1.
(The format of our PDB-style files is described here.)

Timeline for d5e2yc1:

  • d5e2yc1 first appeared in SCOPe 2.05, called d5e2yc_