Lineage for d5e32a_ (5e32 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778145Species Influenza a virus (a/chicken/vietnam/ncvd-093/2008(h5n1)) [TaxId:581024] [279718] (3 PDB entries)
  8. 1778147Domain d5e32a_: 5e32 A: [279719]
    Other proteins in same PDB: d5e32b_
    automated match to d4n5ya_
    complexed with nag; mutant

Details for d5e32a_

PDB Entry: 5e32 (more details), 2.7 Å

PDB Description: crystal structure of h5 hemagglutinin mutant (n224k, q226l, n158d and l133a deletion) from the influenza virus a/chicken/vietnam/ncvd- 093/2008 (h5n1)
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5e32a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e32a_ b.19.1.2 (A:) Hemagglutinin {Influenza a virus (a/chicken/vietnam/ncvd-093/2008(h5n1)) [TaxId: 581024]}
dpgdqicvgyhannsteqvdtimeknitvthaqdilekthngklcnlngvkplilkdcsv
agwllgnpmcdeflnvsewsyivekaspanglcypgdfndyeelkhllsrinhfekikii
pksywsnhetsgvssacsylenpsffrnvvwltkkdntyppikvnytnanqkdllvlwgi
hhpnneaeqkmiyqnlntyvsvgtstlnqrlvpkiatrskvkglsgrmdffwtilkpndt
infdsngnfiapeyaykivkkgdsaimkseleygncntkcqtpigainssmpfhnihplt
igecpkyvksnrlvlatglrnap

SCOPe Domain Coordinates for d5e32a_:

Click to download the PDB-style file with coordinates for d5e32a_.
(The format of our PDB-style files is described here.)

Timeline for d5e32a_:

  • d5e32a_ appears in periodic updates to SCOPe 2.05 starting on 2015-12-02
  • d5e32a_ is called d5e32a1 in SCOPe 2.06
  • d5e32a_ appears in the current release, SCOPe 2.07, called d5e32a1