Lineage for d5e2zb1 (5e2z B:2-175)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041188Domain d5e2zb1: 5e2z B:2-175 [279712]
    Other proteins in same PDB: d5e2za1, d5e2za2, d5e2zb2, d5e2zc1, d5e2zc2, d5e2zd2, d5e2ze1, d5e2ze2, d5e2zf2
    automated match to d4kdmb_
    complexed with nag; mutant

Details for d5e2zb1

PDB Entry: 5e2z (more details), 2.62 Å

PDB Description: crystal structure of h5 hemagglutinin q226l mutant from the influenza virus a/duck/egypt/10185ss/2010 (h5n1) with lsta
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5e2zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e2zb1 h.3.1.1 (B:2-175) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmnt
qfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydk
vrlqlrdnakelgngcfefyhrcdnecmesvrngtydypqyseearlkreeisg

SCOPe Domain Coordinates for d5e2zb1:

Click to download the PDB-style file with coordinates for d5e2zb1.
(The format of our PDB-style files is described here.)

Timeline for d5e2zb1: