Lineage for d1ospo_ (1osp O:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1557223Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 1557224Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 1557225Family b.76.1.1: Outer surface protein [51088] (3 proteins)
  6. 1557226Protein Outer surface protein A [51089] (1 species)
  7. 1557227Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [51090] (2 PDB entries)
  8. 1557228Domain d1ospo_: 1osp O: [27971]
    Other proteins in same PDB: d1osph1, d1osph2, d1ospl1, d1ospl2

Details for d1ospo_

PDB Entry: 1osp (more details), 1.95 Å

PDB Description: crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab
PDB Compounds: (O:) Outer surface protein A

SCOPe Domain Sequences for d1ospo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ospo_ b.76.1.1 (O:) Outer surface protein A {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
tkldeiknalk

SCOPe Domain Coordinates for d1ospo_:

Click to download the PDB-style file with coordinates for d1ospo_.
(The format of our PDB-style files is described here.)

Timeline for d1ospo_: