Lineage for d5e2za1 (5e2z A:11-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040328Species Influenza a virus (a/duck/egypt/10185ss/2010(h5n1)) [TaxId:1092915] [311104] (3 PDB entries)
  8. 2040332Domain d5e2za1: 5e2z A:11-324 [279706]
    Other proteins in same PDB: d5e2za2, d5e2zb1, d5e2zb2, d5e2zc2, d5e2zd1, d5e2zd2, d5e2ze2, d5e2zf1, d5e2zf2
    automated match to d4bh4a_
    complexed with fuc, ful, gal, nag, sia; mutant

Details for d5e2za1

PDB Entry: 5e2z (more details), 2.62 Å

PDB Description: crystal structure of h5 hemagglutinin q226l mutant from the influenza virus a/duck/egypt/10185ss/2010 (h5n1) with lsta
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5e2za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e2za1 b.19.1.2 (A:11-324) Hemagglutinin {Influenza a virus (a/duck/egypt/10185ss/2010(h5n1)) [TaxId: 1092915]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqitpkn
swsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgihhp
ndateqtrlyqnpttyisvgtstlnqklvpkiatrskvkglsgrmeffwtilksndainf
esngnfiapenaykivkkgdstimkseleygdcntkcqtpigainssmpfhnihpltige
cpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d5e2za1:

Click to download the PDB-style file with coordinates for d5e2za1.
(The format of our PDB-style files is described here.)

Timeline for d5e2za1:

  • d5e2za1 first appeared in SCOPe 2.05, called d5e2za_