Lineage for d5dorc_ (5dor C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605773Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2605774Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2605775Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 2605846Protein Integrase (Int) [56353] (2 species)
  7. 2605860Species Enterobacteria phage [TaxId:10679] [311112] (2 PDB entries)
  8. 2605865Domain d5dorc_: 5dor C: [279701]
    automated match to d1aiha_
    complexed with po4, zn

Details for d5dorc_

PDB Entry: 5dor (more details), 2.5 Å

PDB Description: p2 integrase catalytic domain in space group p21
PDB Compounds: (C:) integrase

SCOPe Domain Sequences for d5dorc_:

Sequence, based on SEQRES records: (download)

>d5dorc_ d.163.1.1 (C:) Integrase (Int) {Enterobacteria phage [TaxId: 10679]}
gyltqeeialllaaldgdnkkiailclstgarwgeaarlkaeniihnrvtfvktktnkpr
tvpiseavakmiadnkrgflfpdadyprfrrtmkaikpdlpmgqathalrhsfathfmin
ggsiitlqrilghtrieqtmvyahfapeylqdaislnplrggte

Sequence, based on observed residues (ATOM records): (download)

>d5dorc_ d.163.1.1 (C:) Integrase (Int) {Enterobacteria phage [TaxId: 10679]}
gyltqeeialllaaldgdnkkiailclstgarwgeaarlkaeniihnrvtfvktnkprtv
piseavakmiagflfpdadyprfrrtmkaikpdlpmgqathalrhsfathfminggsiit
lqrilghtrieqtmvyahfapeylqdaislnplrggte

SCOPe Domain Coordinates for d5dorc_:

Click to download the PDB-style file with coordinates for d5dorc_.
(The format of our PDB-style files is described here.)

Timeline for d5dorc_: