Lineage for d5d82b_ (5d82 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896290Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 1896291Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 1896362Species Pseudomonas putida [TaxId:303] [54437] (41 PDB entries)
    Uniprot P07445
  8. 1896384Domain d5d82b_: 5d82 B: [279698]
    automated match to d3t8nf_

Details for d5d82b_

PDB Entry: 5d82 (more details), 1.37 Å

PDB Description: crystal structure of ketosteroid isomerase from pseudomonas putida (pksi); d40n, y16(cl-y)
PDB Compounds: (B:) Delta(5)-3-ketosteroid isomerase

SCOPe Domain Sequences for d5d82b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d82b_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmarxielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

SCOPe Domain Coordinates for d5d82b_:

Click to download the PDB-style file with coordinates for d5d82b_.
(The format of our PDB-style files is described here.)

Timeline for d5d82b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5d82a_