SCOPe 2.05: Domain d5d7nd_: 5d7n D:

Lineage for d5d7nd_ (5d7n D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries)

8. Domain d5d7nd_: 5d7n D: [279694]
   automated match to d4jt9a_
   complexed with 1pe, gol, mg, peg, pg4, pge, zn

Details for d5d7nd_

PDB Entry: 5d7n, 1.83 Å

PDB Description: crystal structure of human sirt3 at an improved resolution

PDB Compounds: (D:) NAD-dependent protein deacetylase sirtuin-3, mitochondrial

SCOPe Domain Sequences for d5d7nd_:

Sequence; same for both SEQRES and ATOM records:

>d5d7nd_ c.31.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaif
elpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgip
asklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpq
rfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdv
aqlgdvvhgveslvellgwteemrdlvqretg

Timeline for d5d7nd_:

• d5d7nd_ is new in SCOPe 2.05-stable
  
• d5d7nd_ appears in SCOPe 2.06
  
• d5d7nd_ appears in the current release, SCOPe 2.08