| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
| Protein automated matches [190312] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries) |
| Domain d5d7ne_: 5d7n E: [279690] automated match to d4jt9a_ complexed with 1pe, gol, mg, peg, pg4, pge, zn |
PDB Entry: 5d7n (more details), 1.83 Å
SCOPe Domain Sequences for d5d7ne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d7ne_ c.31.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaife
lpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgipa
sklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpqr
fllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdva
qlgdvvhgveslvellgwteemrdlvqretg
Timeline for d5d7ne_: