SCOPe 2.08: Domain d5c2eb1: 5c2e B:439-759

Lineage for d5c2eb1 (5c2e B:439-759)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d5c2eb1: 5c2e B:439-759 [279676]
   Other proteins in same PDB: d5c2ea2, d5c2eb2
   automated match to d2ourb_
   complexed with 4px, 4y1, mg, zn

Details for d5c2eb1

PDB Entry: 5c2e, 2.1 Å

PDB Description: pde10 complexed with6-chloro-n-[(2,4-dimethylthiazol-5-yl)methyl]-5- methyl-2-[2-(2-pyridyl)ethoxy]pyrimidin-4-amine

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5c2eb1:

Sequence; same for both SEQRES and ATOM records:

>d5c2eb1 a.211.1.0 (B:439-759) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirge

Timeline for d5c2eb1:

• d5c2eb1 first appeared in SCOPe 2.05, called d5c2eb_
  
• d5c2eb1 appears in SCOPe 2.07