![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
![]() | Protein automated matches [190983] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries) |
![]() | Domain d5c2ea1: 5c2e A:439-759 [279675] Other proteins in same PDB: d5c2ea2, d5c2eb2 automated match to d2ourb_ complexed with 4px, 4y1, mg, zn |
PDB Entry: 5c2e (more details), 2.1 Å
SCOPe Domain Sequences for d5c2ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c2ea1 a.211.1.0 (A:439-759) automated matches {Human (Homo sapiens) [TaxId: 9606]} sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt epllkacrdnlsqwekvirge
Timeline for d5c2ea1: