SCOPe 2.05: Domain d5a6ta_: 5a6t A:

Lineage for d5a6ta_ (5a6t A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
   automatically mapped to Pfam PF00547

6. Protein automated matches [279671] (1 species)
   not a true protein

7. Species Sporosarcina pasteurii [TaxId:1474] [279673] (1 PDB entry)

8. Domain d5a6ta_: 5a6t A: [279674]
   Other proteins in same PDB: d5a6tb_
   automated match to d4ac7a_
   complexed with edo, ni, so3, so4

Details for d5a6ta_

PDB Entry: 5a6t, 1.65 Å

PDB Description: 1.65 a resolution sulphite inhibited sporosarcina pasteurii urease

PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d5a6ta_:

Sequence; same for both SEQRES and ATOM records:

>d5a6ta_ d.8.1.1 (A:) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

Timeline for d5a6ta_:

• d5a6ta_ is new in SCOPe 2.05-stable
  
• d5a6ta_ appears in SCOPe 2.06
  
• d5a6ta_ appears in the current release, SCOPe 2.08