Lineage for d1kopb_ (1kop B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1136597Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1136598Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1136599Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
  6. 1136600Protein Carbonic anhydrase [51071] (10 species)
  7. 1137093Species Neisseria gonorrhoeae [TaxId:485] [51079] (2 PDB entries)
  8. 1137095Domain d1kopb_: 1kop B: [27967]
    complexed with azi, bme, so4, zn

Details for d1kopb_

PDB Entry: 1kop (more details), 1.9 Å

PDB Description: neisseria gonorrhoeae carbonic anhydrase
PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d1kopb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kopb_ b.74.1.1 (B:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]}
hthwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdven
nghtiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplv
lavlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppcte
gvswlvlktydhidqaqaekftravgsennrpvqplnarvvie

SCOPe Domain Coordinates for d1kopb_:

Click to download the PDB-style file with coordinates for d1kopb_.
(The format of our PDB-style files is described here.)

Timeline for d1kopb_: