Lineage for d1kopb_ (1kop B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566493Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 566494Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 566495Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 566496Protein Carbonic anhydrase [51071] (10 species)
  7. 566697Species Neisseria gonorrhoeae [51079] (2 PDB entries)
  8. 566699Domain d1kopb_: 1kop B: [27967]
    complexed with azi, bme, so4, zn

Details for d1kopb_

PDB Entry: 1kop (more details), 1.9 Å

PDB Description: neisseria gonorrhoeae carbonic anhydrase

SCOP Domain Sequences for d1kopb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kopb_ b.74.1.1 (B:) Carbonic anhydrase {Neisseria gonorrhoeae}
hthwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdven
nghtiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplv
lavlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppcte
gvswlvlktydhidqaqaekftravgsennrpvqplnarvvie

SCOP Domain Coordinates for d1kopb_:

Click to download the PDB-style file with coordinates for d1kopb_.
(The format of our PDB-style files is described here.)

Timeline for d1kopb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kopa_