SCOPe 2.08: Domain d4z3le_: 4z3l E:

Lineage for d4z3le_ (4z3l E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein Major tree pollen allergen [55963] (4 species)

7. Species White birch (Betula verrucosa), Bet v 1 [TaxId:3505] [55964] (23 PDB entries)

8. Domain d4z3le_: 4z3l E: [279664]
   automated match to d4a87a_
   complexed with so4; mutant

Details for d4z3le_

PDB Entry: 4z3l, 2.5 Å

PDB Description: crystal structure of birch pollen allergen bet v 1 mutant g26l, d69i, p90l, k97i

PDB Compounds: (E:) major pollen allergen bet v 1-a

SCOPe Domain Sequences for d4z3le_:

Sequence; same for both SEQRES and ATOM records:

>d4z3le_ d.129.3.1 (E:) Major tree pollen allergen {White birch (Betula verrucosa), Bet v 1 [TaxId: 3505]}
gvfnyetettsvipaarlfkafildldnlfpkvapqaissveniegnggpgtikkisfpe
gfpfkyvkirvdevdhtnfkynysvieggligdtleiisneikivatpdggsilkisnky
htkgdhevkaeqvkaskemgetllravesyllahsdayn

Timeline for d4z3le_:

• d4z3le_ first appeared in SCOPe 2.05
  
• d4z3le_ appears in SCOPe 2.07