Lineage for d4yvxa_ (4yvx A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817577Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1817578Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1817793Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 1817794Species Human (Homo sapiens) [TaxId:9606] [102052] (40 PDB entries)
    Uniprot P42330
  8. 1817841Domain d4yvxa_: 4yvx A: [279661]
    automated match to d2fgba_
    complexed with gmr, nap

Details for d4yvxa_

PDB Entry: 4yvx (more details), 2.3 Å

PDB Description: crystal structure of akr1c3 complexed with glimepiride
PDB Compounds: (A:) Aldo-keto reductase family 1 member C3

SCOPe Domain Sequences for d4yvxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yvxa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg
eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy
fnsdsfashpnypys

SCOPe Domain Coordinates for d4yvxa_:

Click to download the PDB-style file with coordinates for d4yvxa_.
(The format of our PDB-style files is described here.)

Timeline for d4yvxa_: