Class b: All beta proteins [48724] (174 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) |
Protein Carbonic anhydrase [51071] (10 species) |
Species Neisseria gonorrhoeae [TaxId:485] [51079] (2 PDB entries) |
Domain d1kopa_: 1kop A: [27966] complexed with azi, bme, so4, zn |
PDB Entry: 1kop (more details), 1.9 Å
SCOPe Domain Sequences for d1kopa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]} hthwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdven nghtiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplv lavlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppcte gvswlvlktydhidqaqaekftravgsennrpvqplnarvvie
Timeline for d1kopa_: