Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
Protein automated matches [190781] (45 species) not a true protein |
Species Helicobacter pylori [TaxId:85963] [189517] (16 PDB entries) |
Domain d4yo8a1: 4yo8 A:3-231 [279655] Other proteins in same PDB: d4yo8a2, d4yo8b2 automated match to d3nm6b_ complexed with 4ez, zn |
PDB Entry: 4yo8 (more details), 2.1 Å
SCOPe Domain Sequences for d4yo8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yo8a1 c.56.2.0 (A:3-231) automated matches {Helicobacter pylori [TaxId: 85963]} qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel
Timeline for d4yo8a1: