Lineage for d3x1ma_ (3x1m A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860573Protein automated matches [190964] (6 species)
    not a true protein
  7. 2860613Species Pseudomonas aeruginosa [TaxId:350703] [279626] (4 PDB entries)
  8. 2860623Domain d3x1ma_: 3x1m A: [279650]
    automated match to d1gn8a_
    complexed with act, coa, dms, fmt, peg

Details for d3x1ma_

PDB Entry: 3x1m (more details), 2.5 Å

PDB Description: crystal structure of phosphopantetheine adenylyltransferase/ppat from pseudomonas aeruginosa with coa
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3x1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x1ma_ c.26.1.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 350703]}
mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh
lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps
ekysfisstlvreiaalggdiskfvhpavadalaerfk

SCOPe Domain Coordinates for d3x1ma_:

Click to download the PDB-style file with coordinates for d3x1ma_.
(The format of our PDB-style files is described here.)

Timeline for d3x1ma_: