Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein automated matches [190964] (5 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:350703] [279626] (4 PDB entries) |
Domain d3x1kd_: 3x1k D: [279647] automated match to d1gn8a_ complexed with anp, dms, fmt, gol, po4 |
PDB Entry: 3x1k (more details), 2.55 Å
SCOPe Domain Sequences for d3x1kd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x1kd_ c.26.1.3 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 350703]} mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps ekysfisstlvreiaalggdiskfvhpavadalaerfk
Timeline for d3x1kd_: