Lineage for d3x1ka_ (3x1k A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119196Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2119353Protein automated matches [190964] (5 species)
    not a true protein
  7. 2119376Species Pseudomonas aeruginosa [TaxId:350703] [279626] (4 PDB entries)
  8. 2119389Domain d3x1ka_: 3x1k A: [279646]
    automated match to d1gn8a_
    complexed with anp, dms, fmt, gol, po4

Details for d3x1ka_

PDB Entry: 3x1k (more details), 2.55 Å

PDB Description: crystal structure of phosphoapantetheine adenylyltransferase ppat/coad with amp-pnp from pseudomonas aerugonosa
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3x1ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x1ka_ c.26.1.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 350703]}
nrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkhl
pnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltpse
kysfisstlvreiaalggdiskfvhpavadalaerfk

SCOPe Domain Coordinates for d3x1ka_:

Click to download the PDB-style file with coordinates for d3x1ka_.
(The format of our PDB-style files is described here.)

Timeline for d3x1ka_: