Lineage for d1koqa_ (1koq A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676371Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 676372Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 676373Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 676374Protein Carbonic anhydrase [51071] (10 species)
  7. 676631Species Neisseria gonorrhoeae [TaxId:485] [51079] (2 PDB entries)
  8. 676634Domain d1koqa_: 1koq A: [27964]

Details for d1koqa_

PDB Entry: 1koq (more details), 1.9 Å

PDB Description: neisseria gonorrhoeae carbonic anhydrase
PDB Compounds: (A:) carbonic anhydrase

SCOP Domain Sequences for d1koqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koqa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]}
thwgytghdspeswgnlseefrlcstgknqspvnitetvsgklpaikvnykpsmvdvenn
ghtiqvnypeggntltvngrtytlkqfhfhvpsenqikgrtfpmeahfvhldenkqplvl
avlyeagktngrlssiwnvmpmtagkvklnqpfdastllpkrlkyyrfagslttppcteg
vswlvlktydhidqaqaekftravgsennrpvqplnarvvie

SCOP Domain Coordinates for d1koqa_:

Click to download the PDB-style file with coordinates for d1koqa_.
(The format of our PDB-style files is described here.)

Timeline for d1koqa_: