Lineage for d4wkna_ (4wkn A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1860705Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1861590Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 1861591Protein automated matches [190781] (36 species)
    not a true protein
  7. 1861712Species Helicobacter pylori [TaxId:85963] [189517] (11 PDB entries)
  8. 1861726Domain d4wkna_: 4wkn A: [279639]
    automated match to d3nm6b_
    complexed with tdi

Details for d4wkna_

PDB Entry: 4wkn (more details), 2 Å

PDB Description: crystal structure of helicobacter pylori 5'-methylthioadenosine/s- adenosyl homocysteine nucleosidase (mtan) complexed with methylthio- dadme-immucillin-a
PDB Compounds: (A:) Aminodeoxyfutalosine nucleosidase

SCOPe Domain Sequences for d4wkna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wkna_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 85963]}
vqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstlt
ttsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaif
ietsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasva
fvcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

SCOPe Domain Coordinates for d4wkna_:

Click to download the PDB-style file with coordinates for d4wkna_.
(The format of our PDB-style files is described here.)

Timeline for d4wkna_: