Lineage for d4wkpa1 (4wkp A:2-230)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889119Species Helicobacter pylori [TaxId:85963] [189517] (16 PDB entries)
  8. 2889129Domain d4wkpa1: 4wkp A:2-230 [279637]
    Other proteins in same PDB: d4wkpa2, d4wkpb2, d4wkpc2, d4wkpd2
    automated match to d3nm6b_
    complexed with 3qa, so4

Details for d4wkpa1

PDB Entry: 4wkp (more details), 1.58 Å

PDB Description: crystal structure of helicobacter pylori 5'-methylthioadenosine/s- adenosyl homocysteine nucleosidase (mtan) complexed with 2-(2- hydroxyethoxy)ethylthiomethyl-dadme-immucillin-a
PDB Compounds: (A:) Aminodeoxyfutalosine nucleosidase

SCOPe Domain Sequences for d4wkpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wkpa1 c.56.2.0 (A:2-230) automated matches {Helicobacter pylori [TaxId: 85963]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

SCOPe Domain Coordinates for d4wkpa1:

Click to download the PDB-style file with coordinates for d4wkpa1.
(The format of our PDB-style files is described here.)

Timeline for d4wkpa1: