SCOPe 2.05: Domain d4s18b_: 4s18 B:

Lineage for d4s18b_ (4s18 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (177 PDB entries)

8. Domain d4s18b_: 4s18 B: [279634]
   automated match to d1kf3a_
   complexed with 1pt

Details for d4s18b_

PDB Entry: 4s18, 2.27 Å

PDB Description: the x-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and oxaliplatin

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d4s18b_:

Sequence, based on SEQRES records:

>d4s18b_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Sequence, based on observed residues (ATOM records):

>d4s18b_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstasssnycnqmmksrnltkdrckpvntfvhesladvqavcsqkn
vackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfda
sv

Timeline for d4s18b_:

• d4s18b_ is new in SCOPe 2.05-stable
  
• d4s18b_ appears in SCOPe 2.06
  
• d4s18b_ appears in the current release, SCOPe 2.08