| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
| Protein automated matches [190964] (6 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:350703] [279626] (4 PDB entries) |
| Domain d4rukd_: 4ruk D: [279632] automated match to d1gn8a_ complexed with act, ca, coa, dms, fmt, gol, pop |
PDB Entry: 4ruk (more details), 2.2 Å
SCOPe Domain Sequences for d4rukd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rukd_ c.26.1.3 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 350703]}
mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh
lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps
ekysfisstlvreiaalggdiskfvhpavadalaerfk
Timeline for d4rukd_: