Lineage for d1urta_ (1urt A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068638Species Mouse (Mus musculus), liver, isozyme V [TaxId:10090] [51078] (4 PDB entries)
  8. 2068645Domain d1urta_: 1urt A: [27963]
    complexed with zn

Details for d1urta_

PDB Entry: 1urt (more details), 2.8 Å

PDB Description: murine carbonic anhydrase v
PDB Compounds: (A:) carbonic anhydrase v

SCOPe Domain Sequences for d1urta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urta_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]}
gtrqspiniqwkdsvydpqlaplrvsydaascrylwntghafqvefddscedsgisggpl
gnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgenglavi
gvflklgahhqalqklvdvlpevrhkdtqvamgdfdpsclmpacrdywtypgslttppla
esvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr

SCOPe Domain Coordinates for d1urta_:

Click to download the PDB-style file with coordinates for d1urta_.
(The format of our PDB-style files is described here.)

Timeline for d1urta_: