SCOPe 2.06: Domain d4rukb_: 4ruk B:

Lineage for d4rukb_ (4ruk B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein automated matches [190964] (5 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:350703] [279626] (4 PDB entries)

8. Domain d4rukb_: 4ruk B: [279627]
   automated match to d1gn8a_
   complexed with act, ca, coa, dms, fmt, gol, pop

Details for d4rukb_

PDB Entry: 4ruk, 2.2 Å

PDB Description: crystal structure of phosphoapantetheine adenylyltransferase ppat/coad with coa and pyrophosphate from pseudomonas aeruginosa

PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d4rukb_:

Sequence; same for both SEQRES and ATOM records:

>d4rukb_ c.26.1.3 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 350703]}
mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh
lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps
ekysfisstlvreiaalggdiskfvhpavadalaerfk

Timeline for d4rukb_:

• d4rukb_ first appeared in SCOPe 2.05
  
• d4rukb_ appears in SCOPe 2.07
  
• d4rukb_ appears in the current release, SCOPe 2.08