Lineage for d2n5za1 (2n5z A:4-82)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926515Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2926516Protein automated matches [190563] (18 species)
    not a true protein
  7. 2926566Species Mycobacterium tuberculosis [TaxId:83332] [279624] (1 PDB entry)
  8. 2926567Domain d2n5za1: 2n5z A:4-82 [279625]
    Other proteins in same PDB: d2n5za2
    automated match to d4ow1a_

Details for d2n5za1

PDB Entry: 2n5z (more details)

PDB Description: mycobacterium tuberculosis: a dynamic view of the resuscitation promoting factor rpfc catalytic domain
PDB Compounds: (A:) Resuscitation-promoting factor RpfC

SCOPe Domain Sequences for d2n5za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n5za1 d.2.1.0 (A:4-82) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gpspnwdavaqcesggnwaantgngkygglqfkpatwaafggvgnpaaasreqqiavanr
vlaeqgldawptcgaasgl

SCOPe Domain Coordinates for d2n5za1:

Click to download the PDB-style file with coordinates for d2n5za1.
(The format of our PDB-style files is described here.)

Timeline for d2n5za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2n5za2