![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
![]() | Protein automated matches [190563] (18 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [279624] (1 PDB entry) |
![]() | Domain d2n5za1: 2n5z A:4-82 [279625] Other proteins in same PDB: d2n5za2 automated match to d4ow1a_ |
PDB Entry: 2n5z (more details)
SCOPe Domain Sequences for d2n5za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n5za1 d.2.1.0 (A:4-82) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} gpspnwdavaqcesggnwaantgngkygglqfkpatwaafggvgnpaaasreqqiavanr vlaeqgldawptcgaasgl
Timeline for d2n5za1: