Lineage for d5er6c_ (5er6 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830847Species Brucella ovis [TaxId:444178] [269551] (3 PDB entries)
  8. 1830852Domain d5er6c_: 5er6 C: [279623]
    automated match to d3osub_
    complexed with act, edo

Details for d5er6c_

PDB Entry: 5er6 (more details), 1.55 Å

PDB Description: crystal structure of an oxidoreductase from brucella ovis
PDB Compounds: (C:) Oxidoreductase, short chain dehydrogenase/reductase family

SCOPe Domain Sequences for d5er6c_:

Sequence, based on SEQRES records: (download)

>d5er6c_ c.2.1.0 (C:) automated matches {Brucella ovis [TaxId: 444178]}
hmellkeklvlvtgagrglgaaissgaaeqgarvilvdidgtaakaqadaltakgfvaeg
haldvtdrdavaaladdilsrfggldvlvnnagvagraafdqpeavevwdrvigvnlega
fnvshalvpalkaakgnvvhlcsvagfvsggstagyvvskgairsltqvmardlaphgir
vnavapgimmsemavaqlnrpggtdwfmnrvmmkrigetsevvdpvvflaspmasyitgt
ilpvdggflaa

Sequence, based on observed residues (ATOM records): (download)

>d5er6c_ c.2.1.0 (C:) automated matches {Brucella ovis [TaxId: 444178]}
hmellkeklvlvtgagrglgaaissgaaeqgarvilvdidgtaakaqadaltakgfvaeg
haldvtdrdavaaladdilsrfggldvlvnnagvagraafdqpeavevwdrvigvnlega
fnvshalvpalkaakgnvvhlcsvagfvsggstagyvvskgairsltqvmardlaphgir
vnavapgimmtdwfmnrvmmkrigetsevvdpvvflaspmasyitgtilpvdggflaa

SCOPe Domain Coordinates for d5er6c_:

Click to download the PDB-style file with coordinates for d5er6c_.
(The format of our PDB-style files is described here.)

Timeline for d5er6c_: