Lineage for d5eo4a_ (5eo4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944593Species Staphylococcus aureus [TaxId:158878] [260692] (8 PDB entries)
  8. 2944594Domain d5eo4a_: 5eo4 A: [279618]
    automated match to d2hlja1

Details for d5eo4a_

PDB Entry: 5eo4 (more details), 2 Å

PDB Description: structural and biochemical characterization of the hypothetical protein sav2348 from staphylococcus aureus.
PDB Compounds: (A:) thioesterase

SCOPe Domain Sequences for d5eo4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eo4a_ d.38.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
mikqlfthtqtvtsefidhnnhmhdanyniifsdvvnrfnyshglslkerenlaytlftl
eehttylselslgdvftvtlyiydydykrlhlfltltkedgtlastnevmmmginqhtrr
sdafpesfstqiahyyknqptitwpeqlghkiaip

SCOPe Domain Coordinates for d5eo4a_:

Click to download the PDB-style file with coordinates for d5eo4a_.
(The format of our PDB-style files is described here.)

Timeline for d5eo4a_: