Lineage for d5e1pa_ (5e1p A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710656Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [47523] (7 PDB entries)
    Uniprot Q42478
  8. 2710660Domain d5e1pa_: 5e1p A: [279615]
    automated match to d1osaa_
    complexed with ca, mpd

    missing some secondary structures that made up less than one-third of the common domain

Details for d5e1pa_

PDB Entry: 5e1p (more details), 1.01 Å

PDB Description: ca(2+)-calmodulin from paramecium tetraurelia qfit disorder model
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d5e1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e1pa_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}
eqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
tidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddev
demireadidgdghinyeefvrmmvs

SCOPe Domain Coordinates for d5e1pa_:

Click to download the PDB-style file with coordinates for d5e1pa_.
(The format of our PDB-style files is described here.)

Timeline for d5e1pa_: