![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.21: Hypothetical Protein YjhP [82469] (2 proteins) |
![]() | Protein automated matches [273612] (2 species) not a true protein |
![]() | Species Thiobacillus denitrificans [TaxId:292415] [279613] (1 PDB entry) |
![]() | Domain d5epea_: 5epe A: [279614] automated match to d1nkvc_ complexed with na, sah |
PDB Entry: 5epe (more details), 1.9 Å
SCOPe Domain Sequences for d5epea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5epea_ c.66.1.21 (A:) automated matches {Thiobacillus denitrificans [TaxId: 292415]} mdiprifnitesahrihnpftpeklatlgaalrleagarvldlgsgsgemlctwardhgi vgtgidlsqlfteqakrraealgvagqvkfihgdaagyvsdekvdvaacvgaswiaggva gtitllaqslepggiilmgepfwrklptteavakachantisdflllpeflasfrklgyd vvemvladqdswdryeaakwltmrrwldanpedelaeevraqlsseperyatntreylgw gvfalmar
Timeline for d5epea_: