Lineage for d5epea_ (5epe A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893495Family c.66.1.21: Hypothetical Protein YjhP [82469] (2 proteins)
  6. 2893501Protein automated matches [273612] (2 species)
    not a true protein
  7. 2893506Species Thiobacillus denitrificans [TaxId:292415] [279613] (1 PDB entry)
  8. 2893507Domain d5epea_: 5epe A: [279614]
    automated match to d1nkvc_
    complexed with na, sah

Details for d5epea_

PDB Entry: 5epe (more details), 1.9 Å

PDB Description: crystal structure of sam-dependent methyltransferase from thiobacillus denitrificans in complex with s-adenosyl-l-homocysteine
PDB Compounds: (A:) SAM-dependent methyltransferase

SCOPe Domain Sequences for d5epea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5epea_ c.66.1.21 (A:) automated matches {Thiobacillus denitrificans [TaxId: 292415]}
mdiprifnitesahrihnpftpeklatlgaalrleagarvldlgsgsgemlctwardhgi
vgtgidlsqlfteqakrraealgvagqvkfihgdaagyvsdekvdvaacvgaswiaggva
gtitllaqslepggiilmgepfwrklptteavakachantisdflllpeflasfrklgyd
vvemvladqdswdryeaakwltmrrwldanpedelaeevraqlsseperyatntreylgw
gvfalmar

SCOPe Domain Coordinates for d5epea_:

Click to download the PDB-style file with coordinates for d5epea_.
(The format of our PDB-style files is described here.)

Timeline for d5epea_: