Lineage for d5dzoa_ (5dzo A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1764975Domain d5dzoa_: 5dzo A: [279611]
    automated match to d2or8a_
    complexed with na, no3

Details for d5dzoa_

PDB Entry: 5dzo (more details), 1.3 Å

PDB Description: crystal structure of human t-cell immunoglobulin and mucin domain protein 1
PDB Compounds: (A:) Hepatitis A virus cellular receptor 1

SCOPe Domain Sequences for d5dzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dzoa_ b.1.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
mvkvggeagpsvtlpchysgavtsmcwnrgscslftcqngivwtngthvtyrkdtrykll
gdlsrrdvsltientavsdsgvyccrvehrgwfndmkitvsleivpp

SCOPe Domain Coordinates for d5dzoa_:

Click to download the PDB-style file with coordinates for d5dzoa_.
(The format of our PDB-style files is described here.)

Timeline for d5dzoa_: