Lineage for d5dzng_ (5dzn G:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033520Domain d5dzng_: 5dzn G: [279604]
    automated match to d3bi9x_

Details for d5dzng_

PDB Entry: 5dzn (more details), 2.3 Å

PDB Description: human t-cell immunoglobulin and mucin domain protein 4
PDB Compounds: (G:) T-cell immunoglobulin and mucin domain-containing protein 4

SCOPe Domain Sequences for d5dzng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dzng_ b.1.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqr

SCOPe Domain Coordinates for d5dzng_:

Click to download the PDB-style file with coordinates for d5dzng_.
(The format of our PDB-style files is described here.)

Timeline for d5dzng_: