SCOPe 2.05: Domain d5dzng_: 5dzn G:

Lineage for d5dzng_ (5dzn G:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d5dzng_: 5dzn G: [279604]
   automated match to d3bi9x_

Details for d5dzng_

PDB Entry: 5dzn, 2.3 Å

PDB Description: human t-cell immunoglobulin and mucin domain protein 4

PDB Compounds: (G:) T-cell immunoglobulin and mucin domain-containing protein 4

SCOPe Domain Sequences for d5dzng_:

Sequence; same for both SEQRES and ATOM records:

>d5dzng_ b.1.1.0 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mvtsetvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrk
sakyrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqr

Timeline for d5dzng_:

• d5dzng_ is new in SCOPe 2.05-stable
  
• d5dzng_ appears in SCOPe 2.06
  
• d5dzng_ appears in the current release, SCOPe 2.08