SCOPe 2.06: Domain d1dmxb_: 1dmx B:

Lineage for d1dmxb_ (1dmx B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Mouse (Mus musculus), liver, isozyme V [TaxId:10090] [51078] (4 PDB entries)

8. Domain d1dmxb_: 1dmx B: [27960]
   complexed with zn

Details for d1dmxb_

PDB Entry: 1dmx, 2.45 Å

PDB Description: murine mitochondrial carbonic anyhdrase v at 2.45 angstroms resolution

PDB Compounds: (B:) murine carbonic anhydrase v

SCOPe Domain Sequences for d1dmxb_:

Sequence; same for both SEQRES and ATOM records:

>d1dmxb_ b.74.1.1 (B:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]}
gtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyffqvefddscedsgisggpl
gnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgenglavi
gvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttppla
esvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr

Timeline for d1dmxb_:

• d1dmxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dmxb_ appears in SCOPe 2.05
  
• d1dmxb_ appears in SCOPe 2.07
  
• d1dmxb_ appears in the current release, SCOPe 2.08