Lineage for d1dmxb_ (1dmx B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171183Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
  4. 171184Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 171185Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 171186Protein Carbonic anhydrase [51071] (9 species)
  7. 171364Species Mouse (Mus musculus), liver, isozyme V [TaxId:10090] [51078] (4 PDB entries)
  8. 171368Domain d1dmxb_: 1dmx B: [27960]

Details for d1dmxb_

PDB Entry: 1dmx (more details), 2.45 Å

PDB Description: murine mitochondrial carbonic anyhdrase v at 2.45 angstroms resolution

SCOP Domain Sequences for d1dmxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmxb_ b.74.1.1 (B:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V}
gtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyffqvefddscedsgisggpl
gnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgenglavi
gvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttppla
esvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr

SCOP Domain Coordinates for d1dmxb_:

Click to download the PDB-style file with coordinates for d1dmxb_.
(The format of our PDB-style files is described here.)

Timeline for d1dmxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dmxa_