Lineage for d5dl1k_ (5dl1 K:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099100Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 protein domains)
    automatically mapped to Pfam PF00574
  6. 2099280Protein automated matches [190149] (9 species)
    not a true protein
  7. 2099439Species Staphylococcus aureus [TaxId:93061] [189958] (6 PDB entries)
  8. 2099510Domain d5dl1k_: 5dl1 K: [279596]
    automated match to d3qwdc_
    complexed with 5c2

Details for d5dl1k_

PDB Entry: 5dl1 (more details), 3 Å

PDB Description: clpp from staphylococcus aureus in complex with av145
PDB Compounds: (K:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d5dl1k_:

Sequence, based on SEQRES records: (download)

>d5dl1k_ c.14.1.1 (K:) automated matches {Staphylococcus aureus [TaxId: 93061]}
liptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyl
yinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmi
hqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeake
yglidevmvpe

Sequence, based on observed residues (ATOM records): (download)

>d5dl1k_ c.14.1.1 (K:) automated matches {Staphylococcus aureus [TaxId: 93061]}
liptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyin
spggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqp
lggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygl
idevmvpe

SCOPe Domain Coordinates for d5dl1k_:

Click to download the PDB-style file with coordinates for d5dl1k_.
(The format of our PDB-style files is described here.)

Timeline for d5dl1k_: