Lineage for d1dmxa_ (1dmx A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (8 species) 
Species Mouse (Mus musculus), liver, isozyme V [TaxId:10090] [51078] (3 PDB entries) 
Domain d1dmxa_: 1dmx A: [27959]
Details for d1dmxa_
PDB Entry: 1dmx (more details), 2.45 Å
PDB Description: murine mitochondrial carbonic anyhdrase v at 2.45 angstroms resolution
SCOP Domain Sequences for d1dmxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dmxa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V}
gtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyffqvefddscedsgisggpl
gnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenykkasvgenglavi
gvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttppla
esvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfr
SCOP Domain Coordinates for d1dmxa_:
Click to download the PDB-style file with coordinates for d1dmxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dmxa_:
- d1dmxa_ appears in SCOP 1.57
- d1dmxa_ appears in the current release, SCOPe 2.08
View in 3D
