Lineage for d2znca_ (2znc A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068630Species Mouse (Mus musculus), isozyme IV [TaxId:10090] [51077] (2 PDB entries)
  8. 2068631Domain d2znca_: 2znc A: [27957]
    complexed with zn

Details for d2znca_

PDB Entry: 2znc (more details), 2.8 Å

PDB Description: murine carbonic anhydrase iv
PDB Compounds: (A:) carbonic anhydrase IV

SCOPe Domain Sequences for d2znca_:

Sequence, based on SEQRES records: (download)

>d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]}
wcyeiqtedprssclgpekwpgackenqqspinivtartkvnprltpfilvgydqkqqwp
iknnqhtvemtlgggaciiggdlparyeavqlhlhwsngndngsehsidgrhfamemhiv
hkkltsskedskdkfavlafmievgdkvnkgfqplvealpsiskphststvresslqdml
ppstkmytyfryngslttpncdetviwtvykqpikihknqflefsknlyydedqklnmkd
nvrplqplgkrqvfksha

Sequence, based on observed residues (ATOM records): (download)

>d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]}
wcyeiqtedprssclgpekwpgackenqqspinivtartkvnprltpfilvgydqkqqwp
iknnqhtvemtlgggaciiggdlparyeavqlhlhwsngndngsehsidgrhfamemhiv
hkklkfavlafmievgdkvnkgfqplvealpsiskphststvresslqdmlppstkmyty
fryngslttpncdetviwtvykqpikihknqflefsknlyydedqklnmkdnvrplqplg
krqvfksha

SCOPe Domain Coordinates for d2znca_:

Click to download the PDB-style file with coordinates for d2znca_.
(The format of our PDB-style files is described here.)

Timeline for d2znca_: